Structure of the p22phox a200g mutant in complex with p47phox peptide
PDB DOI: 10.2210/pdb7yxw/pdb
Classification: OXIDOREDUCTASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2022-02-16 Deposition Author(s): Cukier, C.D. , Komjati, B. , Szlavik, Z. , Vuillard, L.M.
Structure of the p22phox a200g mutant in complex with p47phox peptide
Cukier, C.D. , Komjati, B. , Szlavik, Z. , Vuillard, L.M.
Primary Citation of Related Structures: 7YXW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Cytochrome b-245 light chain | D | 18 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PPSNPPPRPPAEARKKPS |
Neutrophil cytosol factor 1 | A | 131 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GIILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKGKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-02-16 Deposition Author(s): Cukier, C.D. , Komjati, B. , Szlavik, Z. , Vuillard, L.M.