Insight into the c-terminal sh3 domain mediated binding of drosophila drk to sos and dos
PDB DOI: 10.2210/pdb7y4n/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Drosophila Melanogaster
Deposited: 2022-06-15 Deposition Author(s): Ikeya, T. , Inomata, K. , Ito, Y. , Mishima, M. , Pooppadi, M.S. , Sugasawa, H. , Watanabe, R.
Method: SOLUTION NMR Resolution: N.A.
Insight into the c-terminal sh3 domain mediated binding of drosophila drk to sos and dos
Ikeya, T. , Inomata, K. , Ito, Y. , Mishima, M. , Pooppadi, M.S. , Sugasawa, H. , Watanabe, R.
Primary Citation of Related Structures: 7Y4N
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Growth factor receptor-bound protein 2 | A | 60 | Drosophila Melanogaster | GEEMLVQALYDFVPQESGELDFRRGDVITVTDRSDENWWNGEIGNRKGIFPATYVTPYHS |
Method: SOLUTION NMR
Deposited Date: 2022-06-15 Deposition Author(s): Ikeya, T. , Inomata, K. , Ito, Y. , Mishima, M. , Pooppadi, M.S. , Sugasawa, H. , Watanabe, R.