Crystal structure of the second pdz domain from human ptpn13 in complex with apc peptide
PDB DOI: 10.2210/pdb7xty/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2022-05-18 Deposition Author(s): Jing, L.Q. , Ma, W.H. , Sun, X.N. , Wu, D.L. , Zhou, W.J.
Crystal structure of the second pdz domain from human ptpn13 in complex with apc peptide
Jing, L.Q. , Ma, W.H. , Sun, X.N. , Wu, D.L. , Zhou, W.J.
Primary Citation of Related Structures: 7XTY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Tyrosine-protein phosphatase non-receptor type 13 | A | 95 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT |
Tyrosine-protein phosphatase non-receptor type 13 | B | 95 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT |
APC-peptide | C | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RHSGSYLVTSV |
APC-peptide | D | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RHSGSYLVTSV |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-05-18 Deposition Author(s): Jing, L.Q. , Ma, W.H. , Sun, X.N. , Wu, D.L. , Zhou, W.J.