The 0.96 angstrom x-ray structure of the human heart fatty acid-binding protein complexed with arachidic acid
PDB DOI: 10.2210/pdb7x4j/pdb
Classification: LIPID BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2022-03-02 Deposition Author(s): Hayashi, F. , Inoue, Y. , Matsuoka, S. , Murata, M. , Sonoyama, M. , Sugiyama, S. , Tsuchikawa, H.
The 0.96 angstrom x-ray structure of the human heart fatty acid-binding protein complexed with arachidic acid
Hayashi, F. , Inoue, Y. , Matsuoka, S. , Murata, M. , Sonoyama, M. , Sugiyama, S. , Tsuchikawa, H.
Primary Citation of Related Structures: 7X4J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Fatty acid-binding protein, heart | A | 133 | Homo Sapiens | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-03-02 Deposition Author(s): Hayashi, F. , Inoue, Y. , Matsuoka, S. , Murata, M. , Sonoyama, M. , Sugiyama, S. , Tsuchikawa, H.