Crystal structure of human focal adhesion targeting (fat) domain of the focal adhesion kinase
PDB DOI: 10.2210/pdb7w7z/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2021-12-07 Deposition Author(s): Arold, S.T. , Momin, A.A. , Sandholu, A.S.
Crystal structure of human focal adhesion targeting (fat) domain of the focal adhesion kinase
Arold, S.T. , Momin, A.A. , Sandholu, A.S.
Primary Citation of Related Structures: 7W7Z
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Isoform 5 of Focal adhesion kinase 1 | A | 164 | Homo Sapiens | SSPADSYNEGVKPWRLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-12-07 Deposition Author(s): Arold, S.T. , Momin, A.A. , Sandholu, A.S.