PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

7VYW

Crystal structure of the chromodomain of arabidopsis lhp1 in complex with methylated histone h3k9 peptide

PDB DOI: 10.2210/pdb7vyw/pdb

Classification: TRANSCRIPTION
Organism(s): Murine Norovirus Gv/Cr6/2005/Usa , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2021-11-15
Deposition Author(s): Liu, Y. , Min, J. , Zhang, M.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.6 Å

7vyw
Literature

Crystal structure of the chromodomain of arabidopsis lhp1 in complex with methylated histone h3k9 peptide

Liu, Y. , Min, J. , Zhang, M.

Primary Citation of Related Structures: 7VYW


Proteins
Molecule Chains Sequence Length Organism Sequence
Chromo domain-containing protein LHP1 A 56 Murine Norovirus Gv/Cr6/2005/Usa , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GGFYEIEAIRRKRVRKGKVQYLIKWRGWPETANTWEPLENLQSIADVIDAFEGSLK
methylated histone H3K9 peptide B 6 Murine Norovirus Gv/Cr6/2005/Usa , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) QTARKS
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2021-11-15
Deposition Author(s): Liu, Y. , Min, J. , Zhang, M.