Crystal structure of the chromodomain of arabidopsis lhp1 in complex with methylated histone h3k9 peptide
PDB DOI: 10.2210/pdb7vyw/pdb
Classification: TRANSCRIPTION Organism(s): Arabidopsis Thaliana , Synthetic Construct
Deposited: 2021-11-15 Deposition Author(s): Liu, Y. , Min, J. , Zhang, M.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Chromo domain-containing protein LHP1 | A | 56 | Arabidopsis Thaliana , Synthetic Construct | GGFYEIEAIRRKRVRKGKVQYLIKWRGWPETANTWEPLENLQSIADVIDAFEGSLK |
methylated histone H3K9 peptide | B | 6 | Arabidopsis Thaliana , Synthetic Construct | QTARKS |
Method: X-RAY DIFFRACTION