Structure of the transmembrane domain of the cd28 dimer
PDB DOI: 10.2210/pdb7vu5/pdb
Classification: IMMUNE SYSTEM Organism(s): Homo Sapiens
Deposited: 2021-11-01 Deposition Author(s): Cao, R. , Ouyang, B. , Wen, M. , Wu, H.
Structure of the transmembrane domain of the cd28 dimer
Cao, R. , Ouyang, B. , Wen, M. , Wu, H.
Primary Citation of Related Structures: 7VU5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
T-cell-specific surface glycoprotein CD28 | A | 41 | Homo Sapiens | GPSKPFWVLVVVGGVLAFYSLLVTVAFIIFWVRSKRSRLLH |
T-cell-specific surface glycoprotein CD28 | B | 41 | Homo Sapiens | GPSKPFWVLVVVGGVLAFYSLLVTVAFIIFWVRSKRSRLLH |
Method: SOLUTION NMR
Deposited Date: 2021-11-01 Deposition Author(s): Cao, R. , Ouyang, B. , Wen, M. , Wu, H.