Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing three beta-amino acids
PDB DOI: 10.2210/pdb7uzp/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2022-05-09 Deposition Author(s): Bingman, C.A. , Bruchs, A.T. , Gellman, S.H. , Yu, Z.
Method: X-RAY DIFFRACTION Resolution: 2.29 Å
Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing three beta-amino acids
Bingman, C.A. , Bruchs, A.T. , Gellman, S.H. , Yu, Z.
Primary Citation of Related Structures: 7UZP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Parathyroid hormone/parathyroid hormone-related peptide receptor | A | 103 | Homo Sapiens , Synthetic Construct | GDDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFL |
| Parathyroid hormone/parathyroid hormone-related peptide receptor | C | 103 | Homo Sapiens , Synthetic Construct | GDDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFL |
| Parathyroid hormone/parathyroid hormone-related peptide receptor | E | 103 | Homo Sapiens , Synthetic Construct | GDDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFL |
| PTHrP[1-36] 24,28,31 XCP | B | 22 | Homo Sapiens , Synthetic Construct | YQDLRRRFFXHHLXAEXHTAEI |
| PTHrP[1-36] 24,28,31 XCP | D | 22 | Homo Sapiens , Synthetic Construct | YQDLRRRFFXHHLXAEXHTAEI |
| PTHrP[1-36] 24,28,31 XCP | F | 22 | Homo Sapiens , Synthetic Construct | YQDLRRRFFXHHLXAEXHTAEI |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-05-09 Deposition Author(s): Bingman, C.A. , Bruchs, A.T. , Gellman, S.H. , Yu, Z.