Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing one beta-amino acid
PDB DOI: 10.2210/pdb7uzo/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2022-05-09 Deposition Author(s): Bingman, C.A. , Bruchs, A.T. , Gellman, S.H. , Yu, Z.
Method: X-RAY DIFFRACTION Resolution: 1.3 Å
Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing one beta-amino acid
Bingman, C.A. , Bruchs, A.T. , Gellman, S.H. , Yu, Z.
Primary Citation of Related Structures: 7UZO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Parathyroid hormone/parathyroid hormone-related peptide receptor | A | 101 | Homo Sapiens , Synthetic Construct | DVMTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFL |
Peptide from Parathyroid hormone-related protein | B | 23 | Homo Sapiens , Synthetic Construct | YQDLRRRFFLHHLIAEXHTAEIX |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-05-09 Deposition Author(s): Bingman, C.A. , Bruchs, A.T. , Gellman, S.H. , Yu, Z.