Taf14 et domain in complex with c-terminal tail of taf2
PDB DOI: 10.2210/pdb7uhe/pdb
Classification: TRANSCRIPTION Organism(s): Saccharomyces , Synthetic Construct
Deposited: 2022-03-26 Deposition Author(s): Klein, B.J. , Kutateladze, T.G.
Method: X-RAY DIFFRACTION Resolution: 1.66 Å
Taf14 et domain in complex with c-terminal tail of taf2
Klein, B.J. , Kutateladze, T.G.
Primary Citation of Related Structures: 7UHE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription initiation factor TFIID subunit 14 | A | 76 | Saccharomyces , Synthetic Construct | GSASTVKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLYSLPEGLLKSLWDYVKKNT |
| Transcription initiation factor TFIID subunit 14 | C | 76 | Saccharomyces , Synthetic Construct | GSASTVKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLYSLPEGLLKSLWDYVKKNT |
| C-terminal tail of Transcription initiation factor TFIID subunit 2 | B | 12 | Saccharomyces , Synthetic Construct | SRSFMVKIRTKN |
| C-terminal tail of Transcription initiation factor TFIID subunit 2 | D | 12 | Saccharomyces , Synthetic Construct | SRSFMVKIRTKN |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-03-26 Deposition Author(s): Klein, B.J. , Kutateladze, T.G.