Crystal structure of the coiled-coil domain of trim75
PDB DOI: 10.2210/pdb7ug2/pdb
Classification: LIGASE Organism(s): Enterobacter Aerogenes
Deposited: 2022-03-23 Deposition Author(s): Li, X.C. , Lou, X.H. , Ma, B.B. , Zhuang, Y.
Crystal structure of the coiled-coil domain of trim75
Li, X.C. , Lou, X.H. , Ma, B.B. , Zhuang, Y.
Primary Citation of Related Structures: 7UG2
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Tripartite motif-containing protein 75 | A | 59 | Enterobacter Aerogenes | GPGGVTLREQAEAQRSQLTSECEKLMRFLDQEERAAFSRLEDEEMRLEKRLLDNIAALE |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-03-23 Deposition Author(s): Li, X.C. , Lou, X.H. , Ma, B.B. , Zhuang, Y.