Crystal structure of the coiled-coil domain of trim75
PDB DOI: 10.2210/pdb7ug2/pdb
Classification: LIGASE Organism(s): Mus Musculus
Deposited: 2022-03-23 Deposition Author(s): Li, X.C. , Lou, X.H. , Ma, B.B. , Zhuang, Y.
Method: X-RAY DIFFRACTION Resolution: 2.052 Å
Crystal structure of the coiled-coil domain of trim75
Li, X.C. , Lou, X.H. , Ma, B.B. , Zhuang, Y.
Primary Citation of Related Structures: 7UG2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tripartite motif-containing protein 75 | A | 59 | Mus Musculus | GPGGVTLREQAEAQRSQLTSECEKLMRFLDQEERAAFSRLEDEEMRLEKRLLDNIAALE |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-03-23 Deposition Author(s): Li, X.C. , Lou, X.H. , Ma, B.B. , Zhuang, Y.