Eps8 sh3 domain with nleh1 pxxdy motif
PDB DOI: 10.2210/pdb7tzk/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2022-02-15 Deposition Author(s): Cygler, M. , Grishin, A.M.
Eps8 sh3 domain with nleh1 pxxdy motif
Primary Citation of Related Structures: 7TZK
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Epidermal growth factor receptor kinase substrate 8 | A | 64 | Homo Sapiens , Synthetic Construct | SNAQPKKYAKSKYDFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSGFVPNNILDIVRPP |
Epidermal growth factor receptor kinase substrate 8 | B | 64 | Homo Sapiens , Synthetic Construct | SNAQPKKYAKSKYDFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSGFVPNNILDIVRPP |
T3SS secreted effector NleH homolog | C | 12 | Homo Sapiens , Synthetic Construct | PPELPSVDYNSL |
T3SS secreted effector NleH homolog | D | 12 | Homo Sapiens , Synthetic Construct | PPELPSVDYNSL |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-02-15 Deposition Author(s): Cygler, M. , Grishin, A.M.