Chickpea (cicer arientinum) nodule-specific cysteine-rich peptide ncr13: solution nmr structure of the isomer with c4:c10, c15:c30, and c23:c28 disulfide bonds
PDB DOI: 10.2210/pdb7th8/pdb
Classification: ANTIFUNGAL PROTEIN Organism(s): Cicer Arientinum
Deposited: 2022-01-10 Deposition Author(s): Buchko, G.W. , Shah, D.M. , Velivelli, S.L.S. , Zhou, M.
Chickpea (cicer arientinum) nodule-specific cysteine-rich peptide ncr13: solution nmr structure of the isomer with c4:c10, c15:c30, and c23:c28 disulfide bonds
Buchko, G.W. , Shah, D.M. , Velivelli, S.L.S. , Zhou, M.
Primary Citation of Related Structures: 7TH8
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Nodule cysteine-rich protein 13 | A | 33 | Cicer Arientinum | ATKPCQSDKDCKKFACRKPKVPKCINGFCKCVR |
Method: SOLUTION NMR
Deposited Date: 2022-01-10 Deposition Author(s): Buchko, G.W. , Shah, D.M. , Velivelli, S.L.S. , Zhou, M.