Mouse parp13/zap znf5-wwe1-wwe2 bound to adpr
PDB DOI: 10.2210/pdb7sz3/pdb
Classification: ANTIVIRAL PROTEIN Organism(s): Mus Musculus
Deposited: 2021-11-25 Deposition Author(s): Ayanath Kuttiyatveetil, J.R. , Pascal, J.M.
Mouse parp13/zap znf5-wwe1-wwe2 bound to adpr
Ayanath Kuttiyatveetil, J.R. , Pascal, J.M.
Primary Citation of Related Structures: 7SZ3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger CCCH-type antiviral protein 1 | A | 198 | Mus Musculus | SPRMDDHGLKEICLDHLYRGCQQVNCNKNHFHLPYRWQLFILPTWMDFQDMEYIERAYCDPQIEIIVIEKHRINFKKMTCDSYPIRRLSTPSFVEKTLNSVFTTKWLWYWRNELNEYTQYGHESPSHTSSEINSAYLESFFHSCPRGVLQFHAGSQNYELSFQGMIQTNIASKTQRHVVRRPVFVSSKDVEQKRRGPD |
| Zinc finger CCCH-type antiviral protein 1 | B | 198 | Mus Musculus | SPRMDDHGLKEICLDHLYRGCQQVNCNKNHFHLPYRWQLFILPTWMDFQDMEYIERAYCDPQIEIIVIEKHRINFKKMTCDSYPIRRLSTPSFVEKTLNSVFTTKWLWYWRNELNEYTQYGHESPSHTSSEINSAYLESFFHSCPRGVLQFHAGSQNYELSFQGMIQTNIASKTQRHVVRRPVFVSSKDVEQKRRGPD |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-11-25 Deposition Author(s): Ayanath Kuttiyatveetil, J.R. , Pascal, J.M.