Designed trefoil knot protein, variant 1
PDB DOI: 10.2210/pdb7sq3/pdb
Classification: DE NOVO PROTEIN Organism(s): Synthetic Construct
Deposited: 2021-11-04 Deposition Author(s): Bradley, P. , Doyle, L. , Stoddard, B.L. , Takushi, B.
Designed trefoil knot protein, variant 1
Bradley, P. , Doyle, L. , Stoddard, B.L. , Takushi, B.
Primary Citation of Related Structures: 7SQ3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Designed trefoil knot protein, variant 1 | A | 153 | Synthetic Construct | GSSMGSDEQRRELEEKIKFKLAELASKSEEERKEIKLRVIAYVLVQLEDLQKNLSDEQRRELEEKIKFKLAELASKSEEERKEIKLRVIAYVLVQLEDLQKNLSDEQRRELEEKIKFKLAELASKSEEERKEIKLRVIAYVLVQLEDLQKNLS |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-11-04 Deposition Author(s): Bradley, P. , Doyle, L. , Stoddard, B.L. , Takushi, B.