7SN6
U2af65 uhm bound to sf3b155 ulm5
PDB DOI: 10.2210/pdb7sn6/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2021-10-27 Deposition Author(s): Jenkins, J.L. , Kielkopf, C.L. , Loerch, S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
U2af65 uhm bound to sf3b155 ulm5
Jenkins, J.L. , Kielkopf, C.L. , Loerch, S.
Primary Citation of Related Structures: 7SN6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Splicing factor U2AF 65 kDa subunit | A | 106 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW |
| Splicing factor U2AF 65 kDa subunit | B | 106 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW |
| Splicing factor 3B subunit 1 | C | 19 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KRKSRWDETPASQMGGSTP |
| Splicing factor 3B subunit 1 | D | 19 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KRKSRWDETPASQMGGSTP |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2021-10-27 Deposition Author(s): Jenkins, J.L. , Kielkopf, C.L. , Loerch, S.