7SJQ
Ex silico engineering of cystine-dense peptides yielding a potent bispecific t-cell engager
PDB DOI: 10.2210/pdb7sjq/pdb
Classification: ANTITUMOR PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2021-10-18 Deposition Author(s): Rupert, P.B. , Strong, R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2 Å
Ex silico engineering of cystine-dense peptides yielding a potent bispecific t-cell engager
Primary Citation of Related Structures: 7SJQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Programmed cell death 1 ligand 1 | A | 119 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPY |
| Cystine-dense peptide | D | 51 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSEEDCKVHCVKEWMAGKACAERQKSYTIGRAHCSGQKFDVFKCLDHCAAP |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2021-10-18 Deposition Author(s): Rupert, P.B. , Strong, R.