Papain-like protease of sars cov-2, c111s mutant, in complex with plp_snyder608 inhibitor
PDB DOI: 10.2210/pdb7sgu/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Severe Acute Respiratory Syndrome Coronavirus 2
Deposited: 2021-10-07 Deposition Author(s): Azizi, S.A. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Dickinson, B.C. , Endres, M. , Joachimiak, A. , Jones, K. , Kathayat, R. , Lisnyak, V. , Maki, S. , Osipiuk, J. , Snyder, S.A. , Taylor, C. , Tesar, C. , Zhang, Y. , Zhou, Z.
Papain-like protease of sars cov-2, c111s mutant, in complex with plp_snyder608 inhibitor
Azizi, S.A. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Dickinson, B.C. , Endres, M. , Joachimiak, A. , Jones, K. , Kathayat, R. , Lisnyak, V. , Maki, S. , Osipiuk, J. , Snyder, S.A. , Taylor, C. , Tesar, C. , Zhang, Y. , Zhou, Z.
Primary Citation of Related Structures: 7SGU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence | 
| Papain-like protease | A | 318 | Severe Acute Respiratory Syndrome Coronavirus 2 | SNAEVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK | 
Method: X-RAY DIFFRACTION
Deposited Date: 2021-10-07 Deposition Author(s): Azizi, S.A. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Dickinson, B.C. , Endres, M. , Joachimiak, A. , Jones, K. , Kathayat, R. , Lisnyak, V. , Maki, S. , Osipiuk, J. , Snyder, S.A. , Taylor, C. , Tesar, C. , Zhang, Y. , Zhou, Z.
 
                  