Crystal structure of the n-domain of cardiac muscle troponin c tethered to the switch region of cardiac muscle troponin i (orthorhombic form)
PDB DOI: 10.2210/pdb7sc3/pdb
Classification: CONTRACTILE PROTEIN Organism(s): Homo Sapiens
Deposited: 2021-09-27 Deposition Author(s): Sack, J.S.
Crystal structure of the n-domain of cardiac muscle troponin c tethered to the switch region of cardiac muscle troponin i (orthorhombic form)
Primary Citation of Related Structures: 7SC3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Troponin C, slow skeletal and cardiac muscles,Troponin I, cardiac muscle chimera | A | 125 | Homo Sapiens | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKFKRPTLRRVRISADAMMQALLGARAKGHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-09-27 Deposition Author(s): Sack, J.S.