Fragment of streptococcal m87 protein fused to gcn4 adaptor
PDB DOI: 10.2210/pdb7saf/pdb
Classification: CELL ADHESION Organism(s): Grouper Iridovirus , Thermothelomyces Thermophilus
Deposited: 2021-09-22 Deposition Author(s): Ghosh, P. , Kolesinski, P.
Fragment of streptococcal m87 protein fused to gcn4 adaptor
Primary Citation of Related Structures: 7SAF
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
General control transcription factor GCN4/M protein chimera | A | 71 | Grouper Iridovirus , Thermothelomyces Thermophilus | GPGSMKQLEDKVEELLSKNYHLENEVARLKKLVSKLEKQLEEAQKDYSEIEGKLEQFWHDYDKLEKENKEY |
General control transcription factor GCN4/M protein chimera | B | 71 | Grouper Iridovirus , Thermothelomyces Thermophilus | GPGSMKQLEDKVEELLSKNYHLENEVARLKKLVSKLEKQLEEAQKDYSEIEGKLEQFWHDYDKLEKENKEY |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-09-22 Deposition Author(s): Ghosh, P. , Kolesinski, P.