7S7J
Structure of human spastin-ist1 complex.
PDB DOI: 10.2210/pdb7s7j/pdb
Classification: PROTEIN TRANSPORT Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2021-09-16 Deposition Author(s): Skalicky, J.J. , Sundquist, W.I.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.15 Å
Structure of human spastin-ist1 complex.
Skalicky, J.J. , Sundquist, W.I.
Primary Citation of Related Structures: 7S7J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Spastin | A | 84 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EAERVRVFHKQAFEYISIALRIDEDEKAGQKEQAVEWYKKGIEELEKGIAVIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLL |
| IST1 homolog | B | 23 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TSASEDIDFDDLSRRFEELKKKT |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2021-09-16 Deposition Author(s): Skalicky, J.J. , Sundquist, W.I.