Solution nmr structure of substrate bound peptidase domain from pcat1
PDB DOI: 10.2210/pdb7s5j/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Hungateiclostridium Thermocellum (Strain Atcc 27405 / Dsm 1237 / Jcm 9322 / Nbrc 103400 / Ncimb 10682 / Nrrl B-4536 / Vpi 7372)
Deposited: 2021-09-10 Deposition Author(s): Bhattacharya, S. , Palillo, A.
Solution nmr structure of substrate bound peptidase domain from pcat1
Bhattacharya, S. , Palillo, A.
Primary Citation of Related Structures: 7S5J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidase C39 | A | 151 | Hungateiclostridium Thermocellum (Strain Atcc 27405 / Dsm 1237 / Jcm 9322 / Nbrc 103400 / Ncimb 10682 / Nrrl B-4536 / Vpi 7372) | SNAMLRRLFKKKYVCVRQYDLTDAGAACLSSIAQYYGLKMSLAKIREMTGTDTQGTNAYGLIHAAKQLGFSAKGVKASKEDLLKDFRLPAIANVIVDNRLAHFVVIYSIKNRIITVADPGKGIVRYSMDDFCSIWTGGLVLLEPGEAFQKG |
| CtA peptide | B | 24 | Hungateiclostridium Thermocellum (Strain Atcc 27405 / Dsm 1237 / Jcm 9322 / Nbrc 103400 / Ncimb 10682 / Nrrl B-4536 / Vpi 7372) | LNIGRELTDEELMEMTGGSTFSIQ |
Method: SOLUTION NMR
Deposited Date: 2021-09-10 Deposition Author(s): Bhattacharya, S. , Palillo, A.