Structure of sortase a from streptococcus pyogenes with the b7-b8 loop sequence from listeria monocytogenes sortase a
PDB DOI: 10.2210/pdb7s53/pdb
Classification: HYDROLASE Organism(s): Listeria Monocytogenes Serovar 1/2A (Strain Atcc Baa-679 / Egd-E) , Streptococcus Pyogenes
Deposited: 2021-09-09 Deposition Author(s): Amacher, J.F. , Antos, J.M. , Johnson, D.A. , Svendsen, J.E.
Structure of sortase a from streptococcus pyogenes with the b7-b8 loop sequence from listeria monocytogenes sortase a
Amacher, J.F. , Antos, J.M. , Johnson, D.A. , Svendsen, J.E.
Primary Citation of Related Structures: 7S53
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Class A sortase, sortase A chimera | A | 171 | Listeria Monocytogenes Serovar 1/2A (Strain Atcc Baa-679 / Egd-E) , Streptococcus Pyogenes | SSVLQAQMAAQQLPVIGGIAIPELGINLPIFKGLGNTELIYGAGTMKEEQVMGGENNYSLASHHIFGITGSSQMLFSPLERAQNGMSIYLTDKEKIYEYIIKDVFTVAPERVDVIDDTAGLKEVTLVTCDKPTETTKRIIVKGELKTEYDFDKAPADVLKAFNHSYNQVST |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-09-09 Deposition Author(s): Amacher, J.F. , Antos, J.M. , Johnson, D.A. , Svendsen, J.E.