Dna-binding domain of human setmar in complex with hsmar1 terminal inverted repeat (tir) dna
PDB DOI: 10.2210/pdb7s03/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2021-08-28 Deposition Author(s): Chen, Q. , Georgiadis, M.M.
Dna-binding domain of human setmar in complex with hsmar1 terminal inverted repeat (tir) dna
Primary Citation of Related Structures: 7S03
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Histone-lysine N-methyltransferase SETMAR | A | 113 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SMKMMLDKKQIRAIFLFEFKMGRKAAETTRNMNNAFGPGTANERTVQWWFKKFRKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEEMNVNHSTVVRHLKQIGKV |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-08-28 Deposition Author(s): Chen, Q. , Georgiadis, M.M.