X-ray structure of insulin analog glulisine
PDB DOI: 10.2210/pdb7rkd/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2021-07-22 Deposition Author(s): Reyes-Grajeda, J.P.
X-ray structure of insulin analog glulisine
Primary Citation of Related Structures: 7RKD
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin chain A | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
Insulin chain A | C | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
Insulin B chain analog | B | 30 | Homo Sapiens | FVKQHLCGSHLVEALYLVCGERGFFYTPET |
Insulin B chain analog | D | 30 | Homo Sapiens | FVKQHLCGSHLVEALYLVCGERGFFYTPET |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-07-22 Deposition Author(s): Reyes-Grajeda, J.P.