Solution structure of peptide toxin miitx2-mg1a from the venom of the australian giant red bull ant myrmecia gulosa
PDB DOI: 10.2210/pdb7r6p/pdb
Classification: TOXIN Organism(s): Legionella Pneumophila Str. Corby
Deposited: 2021-06-23 Deposition Author(s): Bankala, K. , Chin, Y.K. , Eagle, D. , Robinson, S.D.
Solution structure of peptide toxin miitx2-mg1a from the venom of the australian giant red bull ant myrmecia gulosa
Bankala, K. , Chin, Y.K. , Eagle, D. , Robinson, S.D.
Primary Citation of Related Structures: 7R6P
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
U-myrmeciitoxin(02)-Mg1a | A | 51 | Legionella Pneumophila Str. Corby | GDISDYGDPCSDDLKDYCIHGDCFFLKELNQPACRCYTGYYGSRCEHIDHN |
Method: SOLUTION NMR
Deposited Date: 2021-06-23 Deposition Author(s): Bankala, K. , Chin, Y.K. , Eagle, D. , Robinson, S.D.