0.79a resolution structure of dmso bound cyclophilin d
PDB DOI: 10.2210/pdb7r2h/pdb
Classification: ISOMERASE Organism(s): Homo Sapiens
Deposited: 2022-02-04 Deposition Author(s): Graedler, U. , Silva, D.O.
0.79a resolution structure of dmso bound cyclophilin d
Primary Citation of Related Structures: 7R2H
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidyl-prolyl cis-trans isomerase F, mitochondrial | A | 165 | Homo Sapiens | MGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-02-04 Deposition Author(s): Graedler, U. , Silva, D.O.