Clostridium thermocellum ctcbm50 structure in complex with beta-1,4-glcnac trisaccharide
PDB DOI: 10.2210/pdb7r1l/pdb
Classification: SUGAR BINDING PROTEIN Organism(s): Cellulosimicrobium Cellulans
Deposited: 2022-02-03 Deposition Author(s): Carvalho, A.L. , Costa, R. , Palma, A.S. , Ribeiro, D.O.
Method: X-RAY DIFFRACTION Resolution: 1.45 Å
Clostridium thermocellum ctcbm50 structure in complex with beta-1,4-glcnac trisaccharide
Carvalho, A.L. , Costa, R. , Palma, A.S. , Ribeiro, D.O.
Primary Citation of Related Structures: 7R1L
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Spore coat assembly protein SafA | A | 56 | Cellulosimicrobium Cellulans | MYTVKPGDTMWKIAVKYQIGISEIIAANPQIKNPNLIYPGQKINIPNILEHHHHHH |
Spore coat assembly protein SafA | B | 56 | Cellulosimicrobium Cellulans | MYTVKPGDTMWKIAVKYQIGISEIIAANPQIKNPNLIYPGQKINIPNILEHHHHHH |
Spore coat assembly protein SafA | C | 56 | Cellulosimicrobium Cellulans | MYTVKPGDTMWKIAVKYQIGISEIIAANPQIKNPNLIYPGQKINIPNILEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-02-03 Deposition Author(s): Carvalho, A.L. , Costa, R. , Palma, A.S. , Ribeiro, D.O.