Crystal structure of human calprotectin (s100a8/s100a9) in complex with peptide 3
PDB DOI: 10.2210/pdb7quv/pdb
Classification: METAL BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2022-01-19 Deposition Author(s): Diaz-Perlas, C. , Heinis, C. , Lau, K. , Pojer, F.
Crystal structure of human calprotectin (s100a8/s100a9) in complex with peptide 3
Diaz-Perlas, C. , Heinis, C. , Lau, K. , Pojer, F.
Primary Citation of Related Structures: 7QUV
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protein S100-A9 | B | 122 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPMTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTPLEVLFQ |
Protein S100-A8 | A | 95 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPMLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE |
Peptide 3 | C | 18 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RSPESVAFPMFQSHWYSG |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-01-19 Deposition Author(s): Diaz-Perlas, C. , Heinis, C. , Lau, K. , Pojer, F.