Structural insight into the scribble pdz domains interaction with the oncogenic human t-cell lymphotrophic virus-1 (htlv-1) tax1
PDB DOI: 10.2210/pdb7qs8/pdb
Classification: VIRAL PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2022-01-13 Deposition Author(s): Humbert, P.O. , Javorsky, A. , Kvansakul, M. , Mackie, E.R. , Soares Da Costa, T.P.
Structural insight into the scribble pdz domains interaction with the oncogenic human t-cell lymphotrophic virus-1 (htlv-1) tax1
Humbert, P.O. , Javorsky, A. , Kvansakul, M. , Mackie, E.R. , Soares Da Costa, T.P.
Primary Citation of Related Structures: 7QS8
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protein scribble homolog | A | 93 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSVEEIRLPRAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVRDATHQEAVSALLRPCLELSLLVRRD |
Protein scribble homolog | B | 93 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSVEEIRLPRAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVRDATHQEAVSALLRPCLELSLLVRRD |
Protein Tax-1 | C | 8 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KHFRETEV |
Protein Tax-1 | D | 8 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KHFRETEV |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-01-13 Deposition Author(s): Humbert, P.O. , Javorsky, A. , Kvansakul, M. , Mackie, E.R. , Soares Da Costa, T.P.