Solution structure of the complex between plasmodial znhit3 and nufip1 proteins
PDB DOI: 10.2210/pdb7qdw/pdb
Classification: SIGNALING PROTEIN Organism(s): Klebsiella Pneumoniae Subsp. Pneumoniae (Strain Atcc 700721 / Mgh 78578)
Deposited: 2021-11-30 Deposition Author(s): Chagot, M.E. , Quinternet, M.
Solution structure of the complex between plasmodial znhit3 and nufip1 proteins
Primary Citation of Related Structures: 7QDW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Zinc finger protein, putative | A | 72 | Klebsiella Pneumoniae Subsp. Pneumoniae (Strain Atcc 700721 / Mgh 78578) | GPHMDYDMLTEEQKKKLKEDHTLKILLKNNYVREVFKQFTLSNDKIGYLSHYINDPTIVQVIDHIMKTIDDT |
NUFIP1 domain-containing protein | B | 25 | Klebsiella Pneumoniae Subsp. Pneumoniae (Strain Atcc 700721 / Mgh 78578) | DIYTYEKKLIKSIEYITKNKFFDDS |
Method: SOLUTION NMR
Deposited Date: 2021-11-30 Deposition Author(s): Chagot, M.E. , Quinternet, M.