Crystal structure of a cyclodipeptide synthase from parcubacteria bacterium raac4_od1_1, e174a mutant
PDB DOI: 10.2210/pdb7qaq/pdb
Classification: LIGASE Organism(s): Parcubacteria Bacterium Raac4_Od1_1
Deposited: 2021-11-17 Deposition Author(s): Czekster, C.M. , Harding, C.J. , Sutherland, E.
Method: X-RAY DIFFRACTION Resolution: 2.4 Å
Crystal structure of a cyclodipeptide synthase from parcubacteria bacterium raac4_od1_1, e174a mutant
Czekster, C.M. , Harding, C.J. , Sutherland, E.
Primary Citation of Related Structures: 7QAQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cyclodipeptide synthase | A | 230 | Parcubacteria Bacterium Raac4_Od1_1 | MELHQIRGCHKNDIELKKYNIGVAISLGNKWFSIDNIEKLVKWSLLHTKEYVIIYIADSIHGINLSVRNKLSDSHAEEVAIRYGRNLFIKIKERVSLSFSQDEQAKIIYATWSDIADSKYKEKVKYLYNLYDKNINFKNYIENFVKEWVSKEKRTFNNNEINKFGRYILEELPALMVQVKARGVLFEAYVYPYKTRITEFVGLLQKGEIFPEIKTNILDNHPKIFLEVRE |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-11-17 Deposition Author(s): Czekster, C.M. , Harding, C.J. , Sutherland, E.