Three-dimensional structure of the pgam5 g17l mutant tmd
PDB DOI: 10.2210/pdb7qap/pdb
Classification: MEMBRANE PROTEIN Organism(s): N.A.
Deposited: 2021-11-17 Deposition Author(s): Muhle-Goll, C. , Silber, M.
Method: SOLUTION NMR Resolution: N.A.
Three-dimensional structure of the pgam5 g17l mutant tmd
Primary Citation of Related Structures: 7QAP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Serine/threonine-protein phosphatase PGAM5, mitochondrial | A | 35 | N.A. | AFRQALQLAACGLAGLSAAVLFSAVAVGKPRAGGD |
Method: SOLUTION NMR
Deposited Date: 2021-11-17 Deposition Author(s): Muhle-Goll, C. , Silber, M.