Solution structure of the c terminal domain of mgtc (pa4635) from pseudomonas aeruginosa
PDB DOI: 10.2210/pdb7qa5/pdb
Classification: UNKNOWN FUNCTION Organism(s): Pseudomonas Aeruginosa (Strain Atcc 15692 / Dsm 22644 / Cip 104116 / Jcm 14847 / Lmg 12228 / 1C / Prs 101 / Pao1)
Deposited: 2021-11-16 Deposition Author(s): Barthe, P. , Cohen-Gonsaud, M.
Solution structure of the c terminal domain of mgtc (pa4635) from pseudomonas aeruginosa
Barthe, P. , Cohen-Gonsaud, M.
Primary Citation of Related Structures: 7QA5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protein MgtC | A | 97 | Pseudomonas Aeruginosa (Strain Atcc 15692 / Dsm 22644 / Cip 104116 / Jcm 14847 / Lmg 12228 / 1C / Prs 101 / Pao1) | GPHMASEAEQRYEVQIVCRAEDEIQVRSLMLHSLGSSDLRLQSLHSEDLDNPAKLEVRAELLGTPEAPAQLERLVSRVSLEKGVSSVRWQVFELAAD |
Method: SOLUTION NMR
Deposited Date: 2021-11-16 Deposition Author(s): Barthe, P. , Cohen-Gonsaud, M.