7Q4N
Transcription factor cdx2 bound to hydroxymethylated dna
PDB DOI: 10.2210/pdb7q4n/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2021-11-01 Deposition Author(s): Morgunova, E. , Popov, A. , Taipale, J. , Yin, Y.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 3.2 Å
Transcription factor cdx2 bound to hydroxymethylated dna
Morgunova, E. , Popov, A. , Taipale, J. , Yin, Y.
Primary Citation of Related Structures: 7Q4N
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Homeobox protein CDX-2 | K | 67 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQ |
| Homeobox protein CDX-2 | C | 67 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQ |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2021-11-01 Deposition Author(s): Morgunova, E. , Popov, A. , Taipale, J. , Yin, Y.