7PW0
Crystal structure of the c-src sh3 domain n112g-n113y-t114n-e115h mutant
PDB DOI: 10.2210/pdb7pw0/pdb
Classification: PROTEIN BINDING Organism(s): Gallus Gallus
Deposited: 2021-10-05 Deposition Author(s): Camara-Artigas, A. , Salinas Garcia, M.C.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Crystal structure of the c-src sh3 domain n112g-n113y-t114n-e115h mutant
Camara-Artigas, A. , Salinas Garcia, M.C.
Primary Citation of Related Structures: 7PW0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | A | 60 | Gallus Gallus | GVTTFVALYDYESRTETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
| Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | B | 60 | Gallus Gallus | GVTTFVALYDYESRTETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
| Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | C | 60 | Gallus Gallus | GVTTFVALYDYESRTETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
| Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | D | 60 | Gallus Gallus | GVTTFVALYDYESRTETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
| Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | E | 60 | Gallus Gallus | GVTTFVALYDYESRTETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
| Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | F | 60 | Gallus Gallus | GVTTFVALYDYESRTETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
| Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | G | 60 | Gallus Gallus | GVTTFVALYDYESRTETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
| Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | H | 60 | Gallus Gallus | GVTTFVALYDYESRTETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2021-10-05 Deposition Author(s): Camara-Artigas, A. , Salinas Garcia, M.C.