Crystal structure of the c-src sh3 domain n112g-n113y-t114n-e115h mutant
PDB DOI: 10.2210/pdb7pw0/pdb
Classification: PROTEIN BINDING Organism(s): Caldanaerobius
Deposited: 2021-10-05 Deposition Author(s): Camara-Artigas, A. , Salinas Garcia, M.C.
Crystal structure of the c-src sh3 domain n112g-n113y-t114n-e115h mutant
Camara-Artigas, A. , Salinas Garcia, M.C.
Primary Citation of Related Structures: 7PW0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | A | 60 | Caldanaerobius | GVTTFVALYDYESRTETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | B | 60 | Caldanaerobius | GVTTFVALYDYESRTETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | C | 60 | Caldanaerobius | GVTTFVALYDYESRTETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | D | 60 | Caldanaerobius | GVTTFVALYDYESRTETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | E | 60 | Caldanaerobius | GVTTFVALYDYESRTETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | F | 60 | Caldanaerobius | GVTTFVALYDYESRTETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | G | 60 | Caldanaerobius | GVTTFVALYDYESRTETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | H | 60 | Caldanaerobius | GVTTFVALYDYESRTETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-10-05 Deposition Author(s): Camara-Artigas, A. , Salinas Garcia, M.C.