Crystal structure of the c-src sh3 domain e93v-s94a-r95s-t96g mutant
PDB DOI: 10.2210/pdb7pvy/pdb
Classification: PROTEIN BINDING Organism(s): Gallus Gallus
Deposited: 2021-10-05 Deposition Author(s): Camara-Artigas, A. , Salinas Garcia, M.C.
Method: X-RAY DIFFRACTION Resolution: 1.4 Å
Crystal structure of the c-src sh3 domain e93v-s94a-r95s-t96g mutant
Camara-Artigas, A. , Salinas Garcia, M.C.
Primary Citation of Related Structures: 7PVY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Isoform 2 of Proto-oncogene tyrosine-protein kinase Src | A | 61 | Gallus Gallus | GGVTTFVALYDYVASGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-10-05 Deposition Author(s): Camara-Artigas, A. , Salinas Garcia, M.C.