7PVX
Crystal structure of the c-src sh3 domain mutant e93v-s94a-r95s-t96g-n112g-n113y-t114n-e115h in complex with the synthetic peptide vsl12
PDB DOI: 10.2210/pdb7pvx/pdb
Classification: PROTEIN BINDING Organism(s): Gallus Gallus , Synthetic Construct
Deposited: 2021-10-05 Deposition Author(s): Camara-Artigas, A. , Salinas Garcia, M.C.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.43 Å
Crystal structure of the c-src sh3 domain mutant e93v-s94a-r95s-t96g-n112g-n113y-t114n-e115h in complex with the synthetic peptide vsl12
Camara-Artigas, A. , Salinas Garcia, M.C.
Primary Citation of Related Structures: 7PVX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | A | 60 | Gallus Gallus , Synthetic Construct | GVTTFVALYDYVASGETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
| Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | C | 60 | Gallus Gallus , Synthetic Construct | GVTTFVALYDYVASGETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
| VSL12 peptide | B | 12 | Gallus Gallus , Synthetic Construct | VSLARRPLPPLP |
| VSL12 peptide | D | 12 | Gallus Gallus , Synthetic Construct | VSLARRPLPPLP |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2021-10-05 Deposition Author(s): Camara-Artigas, A. , Salinas Garcia, M.C.