Structure of insulin receptor-related receptor's transmembrane domain
PDB DOI: 10.2210/pdb7pl4/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2021-08-28 Deposition Author(s): Bershatsky, Y.V. , Bocharov, E.V. , Bocharova, O.V. , Nadezhdin, K.D.
Structure of insulin receptor-related receptor's transmembrane domain
Bershatsky, Y.V. , Bocharov, E.V. , Bocharova, O.V. , Nadezhdin, K.D.
Primary Citation of Related Structures: 7PL4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin receptor-related protein beta chain | A | 31 | Homo Sapiens | GGLHVLLTATPVGLTLLIVLAALGFFYGKKR |
Method: SOLUTION NMR
Deposited Date: 2021-08-28 Deposition Author(s): Bershatsky, Y.V. , Bocharov, E.V. , Bocharova, O.V. , Nadezhdin, K.D.