7PHT
Structure of insulin receptor's transmembrane domain
PDB DOI: 10.2210/pdb7pht/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2021-08-18 Deposition Author(s): Bershatsky, Y.V. , Bocharov, E.V. , Bocharova, O.V. , Nadezhdin, K.D.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure of insulin receptor's transmembrane domain
Bershatsky, Y.V. , Bocharov, E.V. , Bocharova, O.V. , Nadezhdin, K.D.
Primary Citation of Related Structures: 7PHT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Isoform Long of Insulin receptor | A | 30 | Homo Sapiens | NIAKIIIGPLIFVFLFSVVIGSIYLFLRKR |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2021-08-18 Deposition Author(s): Bershatsky, Y.V. , Bocharov, E.V. , Bocharova, O.V. , Nadezhdin, K.D.