Structure of insulin-like growth factor 1 receptor's transmembrane domain
PDB DOI: 10.2210/pdb7ph8/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica
Deposited: 2021-08-16 Deposition Author(s): Bershatsky, Y.V. , Bocharov, E.V. , Bocharova, O.V. , Nadezhdin, K.D.
Structure of insulin-like growth factor 1 receptor's transmembrane domain
Bershatsky, Y.V. , Bocharov, E.V. , Bocharova, O.V. , Nadezhdin, K.D.
Primary Citation of Related Structures: 7PH8
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin-like growth factor 1 receptor | A | 31 | Salmonella Enterica | NFIHLIIALPVAVLLIVGGLVIMLYVFHRKR |
Method: SOLUTION NMR
Deposited Date: 2021-08-16 Deposition Author(s): Bershatsky, Y.V. , Bocharov, E.V. , Bocharova, O.V. , Nadezhdin, K.D.