Crystal structure of unlinked ns2b-ns3 protease from zika virus in complex with inhibitor mi-2221
PDB DOI: 10.2210/pdb7pg1/pdb
Classification: VIRAL PROTEIN Organism(s): Zika Virus , Synthetic Construct
Deposited: 2021-08-12 Deposition Author(s): Heine, A. , Huber, S. , Steinmetzer, T.
Crystal structure of unlinked ns2b-ns3 protease from zika virus in complex with inhibitor mi-2221
Heine, A. , Huber, S. , Steinmetzer, T.
Primary Citation of Related Structures: 7PG1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Serine protease subunit NS2B | A | 53 | Zika Virus , Synthetic Construct | MTGKSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMRE |
| Serine protease NS3 | B | 178 | Zika Virus , Synthetic Construct | GSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKREEETPVE |
| Inhibitor MI-2221 | D | 6 | Zika Virus , Synthetic Construct | XGXGKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-08-12 Deposition Author(s): Heine, A. , Huber, S. , Steinmetzer, T.