Crystal structure of the holo-acyl carrier protein (holo-acpp) from pseudomonas putida kt2440. produced as an apo/holo mixture.
PDB DOI: 10.2210/pdb7pdi/pdb
Classification: LIPID BINDING PROTEIN Organism(s): Pseudomonas Putida (Strain Atcc 47054 / Dsm 6125 / Ncimb 11950 / Kt2440)
Deposited: 2021-08-05 Deposition Author(s): Mandyoli, L. , Sewell, B.T. , Trindade, M. , Van Zyl, L. , Venter, P.
Crystal structure of the holo-acyl carrier protein (holo-acpp) from pseudomonas putida kt2440. produced as an apo/holo mixture.
Mandyoli, L. , Sewell, B.T. , Trindade, M. , Van Zyl, L. , Venter, P.
Primary Citation of Related Structures: 7PDI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Acyl carrier protein | A | 82 | Pseudomonas Putida (Strain Atcc 47054 / Dsm 6125 / Ncimb 11950 / Kt2440) | GPLGSSTIEERVKKIVAEQLGVKEEEVTVEKSFVDDLGADXLDTVELVMALEEEFETEIPDEEAEKITTVQAAIDYVKAHQA |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-08-05 Deposition Author(s): Mandyoli, L. , Sewell, B.T. , Trindade, M. , Van Zyl, L. , Venter, P.