The structure of the human tetrameric ll-37 peptide in a channel conformation
PDB DOI: 10.2210/pdb7pdc/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Homo Sapiens
Deposited: 2021-08-05 Deposition Author(s): Sancho-Vaello, E. , Zeth, K.
The structure of the human tetrameric ll-37 peptide in a channel conformation
Primary Citation of Related Structures: 7PDC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cathelicidin antimicrobial peptide | A | 37 | Homo Sapiens | [LL-37, 37 aa] |
| Cathelicidin antimicrobial peptide | B | 37 | Homo Sapiens | [LL-37, 37 aa] |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-08-05 Deposition Author(s): Sancho-Vaello, E. , Zeth, K.