Burg (holo) in complex with 2-hydroxy-2-(hydroxy(isopropyl)amino)acetate (11): biosynthesis of cyclopropanolrings in bacterial toxins
PDB DOI: 10.2210/pdb7pcl/pdb
Classification: LYASE Organism(s): Burkholderia Thailandensis (Strain Atcc 700388 / Dsm 13276 / Cip 106301 / E264)
Deposited: 2021-08-03 Deposition Author(s): Groll, M. , Hertweck, C. , Ishida, K. , Ishida, M. , Kries, H. , Trottmann, F.
Burg (holo) in complex with 2-hydroxy-2-(hydroxy(isopropyl)amino)acetate (11): biosynthesis of cyclopropanolrings in bacterial toxins
Groll, M. , Hertweck, C. , Ishida, K. , Ishida, M. , Kries, H. , Trottmann, F.
Primary Citation of Related Structures: 7PCL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ketol-acid reductoisomerase | A | 358 | Burkholderia Thailandensis (Strain Atcc 700388 / Dsm 13276 / Cip 106301 / E264) | GSHMASNDLIYQDEHASLQPLEGRTVAVIGYGIQGRAFAANLRDSGVAVRVGNIDDRYFELARAEGHRVTNIAEAVAHADIVLLLIPDEAHGAVFDVDIAPNLRDGALLCVAHGHSLVQGDVRPLPGRDLAMLAPRMYGDPIRRYYLAGQGAPAYFDIVADHTGRARDRVLAIARAVGFTRAGVMALGYRQETFLDLFQEQFLAPALVDLVETGFQVLVERGFNPKAALLEVYGSGEMGKMMLDGADIGLDEVVALQGSPTCQVGYHRWRGRTLPTAVRELAARVLDQIEGGDFSAYLKEQASNDYASLDDARRAALKRPLNVAHAQVRAAFRFPTEAAGGLYQAAQAPADVEPEAAR |
| Ketol-acid reductoisomerase | B | 358 | Burkholderia Thailandensis (Strain Atcc 700388 / Dsm 13276 / Cip 106301 / E264) | GSHMASNDLIYQDEHASLQPLEGRTVAVIGYGIQGRAFAANLRDSGVAVRVGNIDDRYFELARAEGHRVTNIAEAVAHADIVLLLIPDEAHGAVFDVDIAPNLRDGALLCVAHGHSLVQGDVRPLPGRDLAMLAPRMYGDPIRRYYLAGQGAPAYFDIVADHTGRARDRVLAIARAVGFTRAGVMALGYRQETFLDLFQEQFLAPALVDLVETGFQVLVERGFNPKAALLEVYGSGEMGKMMLDGADIGLDEVVALQGSPTCQVGYHRWRGRTLPTAVRELAARVLDQIEGGDFSAYLKEQASNDYASLDDARRAALKRPLNVAHAQVRAAFRFPTEAAGGLYQAAQAPADVEPEAAR |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-08-03 Deposition Author(s): Groll, M. , Hertweck, C. , Ishida, K. , Ishida, M. , Kries, H. , Trottmann, F.