Ultra high resolution x-ray structure of orthorhombic bovine pancreatic ribonuclease at 100k
PDB DOI: 10.2210/pdb7p4r/pdb
Classification: HYDROLASE Organism(s): Bos Taurus
Deposited: 2021-07-12 Deposition Author(s): Cooper, J.B. , Howlin, B.J. , Lisgarten, D.R. , Lisgarten, J.N. , Lobley, C.M.C. , Najmudin, S. , Naylor, C.E. , Palmer, R.A.
Ultra high resolution x-ray structure of orthorhombic bovine pancreatic ribonuclease at 100k
Cooper, J.B. , Howlin, B.J. , Lisgarten, D.R. , Lisgarten, J.N. , Lobley, C.M.C. , Najmudin, S. , Naylor, C.E. , Palmer, R.A.
Primary Citation of Related Structures: 7P4R
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ribonuclease pancreatic | AAA | 124 | Bos Taurus | KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-07-12 Deposition Author(s): Cooper, J.B. , Howlin, B.J. , Lisgarten, D.R. , Lisgarten, J.N. , Lobley, C.M.C. , Najmudin, S. , Naylor, C.E. , Palmer, R.A.