7P2O
Nmr solution structure of sud-c domain of sars-cov-2
PDB DOI: 10.2210/pdb7p2o/pdb
Classification: VIRAL PROTEIN Organism(s): Severe Acute Respiratory Syndrome Coronavirus 2
Deposited: 2021-07-06 Deposition Author(s): Fourkiotis, N.K. , Gallo, A. , Spyroulias, G.A. , Tsika, A.C.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of sud-c domain of sars-cov-2
Fourkiotis, N.K. , Gallo, A. , Spyroulias, G.A. , Tsika, A.C.
Primary Citation of Related Structures: 7P2O
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Non-structural protein 3 | A | 66 | Severe Acute Respiratory Syndrome Coronavirus 2 | GSEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLS |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2021-07-06 Deposition Author(s): Fourkiotis, N.K. , Gallo, A. , Spyroulias, G.A. , Tsika, A.C.