7OQ1
Nak s-elm mutant with na+ and k+
PDB DOI: 10.2210/pdb7oq1/pdb
Classification: TRANSPORT PROTEIN Organism(s): Bacillus Cereus (Strain Atcc 14579 / Dsm 31 / Jcm 2152 / Nbrc 15305 / Ncimb 9373 / Nrrl B-3711)
Deposited: 2021-06-02 Deposition Author(s): Minniberger, S. , Plested, A.J.R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.85 Å
Nak s-elm mutant with na+ and k+
Minniberger, S. , Plested, A.J.R.
Primary Citation of Related Structures: 7OQ1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Potassium channel protein | A | 96 | Bacillus Cereus (Strain Atcc 14579 / Dsm 31 / Jcm 2152 / Nbrc 15305 / Ncimb 9373 / Nrrl B-3711) | MWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGSELMPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVPR |
| Potassium channel protein | B | 96 | Bacillus Cereus (Strain Atcc 14579 / Dsm 31 / Jcm 2152 / Nbrc 15305 / Ncimb 9373 / Nrrl B-3711) | MWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGSELMPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVPR |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2021-06-02 Deposition Author(s): Minniberger, S. , Plested, A.J.R.