Wild type carbonic anhydrase ii with bound ircp* complex to generate an artificial transfer hydrogenase (athase)
PDB DOI: 10.2210/pdb7onp/pdb
Classification: OXIDOREDUCTASE Organism(s): Homo Sapiens
Deposited: 2021-05-25 Deposition Author(s): Cotelle, Y. , Dongping, C. , Rebelein, J.G. , Stein, A. , Ward, T.R.
Wild type carbonic anhydrase ii with bound ircp* complex to generate an artificial transfer hydrogenase (athase)
Cotelle, Y. , Dongping, C. , Rebelein, J.G. , Stein, A. , Ward, T.R.
Primary Citation of Related Structures: 7ONP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Carbonic anhydrase 2 | AAA | 260 | Homo Sapiens | MAHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-05-25 Deposition Author(s): Cotelle, Y. , Dongping, C. , Rebelein, J.G. , Stein, A. , Ward, T.R.