Nmr structure of the bak transmembrane helix in lipid nanodiscs
PDB DOI: 10.2210/pdb7ofo/pdb
Classification: APOPTOSIS Organism(s): Homo Sapiens
Deposited: 2021-05-05 Deposition Author(s): Hagn, F. , Sperl, L.E.
Nmr structure of the bak transmembrane helix in lipid nanodiscs
Primary Citation of Related Structures: 7OFO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bcl-2 homologous antagonist/killer | A | 30 | Homo Sapiens | SLGNGPILNVLVVLGVVLLGQFVVRRFFKS |
Method: SOLUTION NMR
Deposited Date: 2021-05-05 Deposition Author(s): Hagn, F. , Sperl, L.E.